r 2016 b Search Results


90
Diversified Biotech Inc diversified biotech 9186 1000 microtube tough
Diversified Biotech 9186 1000 Microtube Tough, supplied by Diversified Biotech Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2016+b/pmc08256429-371-130-36?v=Diversified+Biotech+Inc
Average 90 stars, based on 1 article reviews
diversified biotech 9186 1000 microtube tough - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

97
MathWorks Inc r 2016b global optimization toolbox
R 2016b Global Optimization Toolbox, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 97/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2016+b/10__1080_slash_0305215x__2020__1722118-174-21-20?v=MathWorks+Inc
Average 97 stars, based on 1 article reviews
r 2016b global optimization toolbox - by Bioz Stars, 2026-07
97/100 stars
  Buy from Supplier

96
MathWorks Inc matlab r 2016b
Matlab R 2016b, supplied by MathWorks Inc, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/r+2016+b/pm30560303-93-10-13?v=MathWorks+Inc
Average 96 stars, based on 1 article reviews
matlab r 2016b - by Bioz Stars, 2026-07
96/100 stars
  Buy from Supplier

N/A
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
  Buy from Supplier

N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307
  Buy from Supplier

N/A
Recombinant human AK5 protein (His tag)
  Buy from Supplier

N/A
Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA. Rabbit polyclonal Transportin 2 antibody.
  Buy from Supplier

N/A
Rabbit polyclonal LCN2 antibody (biotin)
  Buy from Supplier

N/A
Diversified Biotech TTLW 2016 Laser Tough Tags 1 28 x 0 50in White 2 125 Labels Unit1 28 x 0 50in White
  Buy from Supplier

N/A
The ADAM15 Antibody RM0147 6D34 Biotin from Novus Biologicals is a rat monoclonal antibody to ADAM15 This antibody reacts with mouse The ADAM15 Antibody RM0147 6D34 Biotin has been validated for the following applications Western
  Buy from Supplier

N/A
Rabbit polyclonal NFKB-p65 antibody
  Buy from Supplier

N/A
The IgG F(ab) Antibody (RMG05) [Biotin] from Novus is a IgG F(ab) antibody to IgG F(ab). This antibody reacts with Mouse. The IgG F(ab) antibody has been validated for the following applications: ELISA.
  Buy from Supplier

Image Search Results